PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC005064.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 374aa    MW: 41286 Da    PI: 4.8533
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC005064.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.1e-33176230155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   k+r+rWtpe He+Fveav+qLGGs++AtPk +l+lm+v+gLt++hvkSHLQkYR+
  EcC005064.40 176 KARMRWTPEHHEAFVEAVNQLGGSDRATPKGVLKLMNVEGLTIYHVKSHLQKYRT 230
                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.82173233IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-31174232IPR009057Homeodomain-like
SuperFamilySSF466891.79E-18174230IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-24176230IPR006447Myb domain, plants
PfamPF002492.1E-9178229IPR001005SANT/Myb domain
PfamPF143792.9E-22263309IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
VTQMLFKNGT VGSGLSSASG CTSDICFSSP QQPERHAQYS PFISPASVIR TSTPPIGFPR  60
TEVQATALTD IPKESKDVLW DPNQLQDFLY SENVPSQNVQ LESRGAVVGC DNQSAGSDLI  120
WTENFGEAMD LDWSKFLADD DAIEPSKPPL AVQGQSLPPA ESSAAANQLS SAPSSKARMR  180
WTPEHHEAFV EAVNQLGGSD RATPKGVLKL MNVEGLTIYH VKSHLQKYRT ARYKPDSAES  240
EGSSEKKLSS LEDMKSLDLK ATMNITEALR MQMEVQKQLH EQLEIQRKLQ LRIEEQGRCL  300
QMLFEKQRNQ TEATEQPEAE KGLETTNPSS SPGESSLNMN KRQKVSEART TDDDNPDEGE  360
MGLPSPKRVR GHEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043308.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN51e-72PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A059D5200.0A0A059D520_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s03750.11e-96(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.39e-61G2-like family protein